CAS Number: 132699-72-0Molecular Weight: 4184.89Salt Form: TFAPurity: >95%Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Trp-Leu-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Gln-Thr-Ala-Pro-Tyr-Gly-Leu-Gly-Asn-Pro-Pro-OH [Cys1-Cys15, Cys3-Cys11]Sequence (1-letter): CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OHStorage: -20 °C or below
Big Endothelin-2 is the precursor to the vasoconstricting peptide Endothelin-2 (ET-2). It is hydrolyzed by endothelin converting enzyme (ECE).
| Categories | Peptides |
|---|
| Filter | Cardiovascular, Neuropeptides & Hormones |
|---|