Molecular Weight: 3349.65Salt Form: TFAPurity: >96%Sequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Ser-Gly-Glu-Leu-Phe-Asp-Ala-OHSequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYSGELFDA-OHStorage: -20 °C or below
Leumorphin is an endogenous opioid peptide which corresponds to the 226-254 fragment of Preproenkephalin B. It is also known as Dynorphin B1-29. Leumorphin is potent and selective κ-opioid receptor agonist.
| Categories | Peptides |
|---|
| Filter | Neuropeptides & Hormones |
|---|