CAS Number: 124584-08-3Molecular Weight: 3464.10Salt Form: TFAPurity: >90%Sequence (3-letter): Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH [Cys10-Cys26]Sequence (1-letter): SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OHStorage: -20 °C or below
Brain Natriuretic Peptide (BNP) (1-32) is a bioactive fragment of the 108-aa inactive precursor pro-BNP. Like all natriuretic peptides, BNP (1-32) has an important role in cardiac homeostasis. It binds to the NPR-A receptor and its actions include vasodilation and inhibition of the renal-angiotensin-aldosterone sysntem (RAAS).
| Categories | Peptides | 
|---|
| Filter | Cardiovascular, Neuropeptides & Hormones | 
|---|